PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009770986.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 237aa    MW: 26400.6 Da    PI: 10.2669
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009770986.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA84.71.4e-2672126258
       CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      p++VNaKQy++Il+RR+ Rak e e+kl  k rkp+lh SRh hA+rRpRg gGrF
  XP_009770986.1  72 GPIFVNAKQYHGILRRRKFRAK-EMENKL-LKPRKPFLHLSRHLHAMRRPRGGGGRF 126
                     69*******************9.566999.9*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.2E-2969129IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115230.98970129IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.5E-2373126IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.7E-207395IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.7E-20103126IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
SQSGDSKSSE KLSNVVDGVS MKSSNTDYQG HFEPLIYAKY PYGEKSLGLF STYGSQVSGR  60
VMLPLNLTSD EGPIFVNAKQ YHGILRRRKF RAKEMENKLL KPRKPFLHLS RHLHAMRRPR  120
GGGGRFLNTR KMNGSTNDGT TKTSNRKSQP TGSQNSEVLQ SDHIGNFNSP KETTSRMSCN  180
SSEVTSFYSR GDLDTYPVHN PRPSVQAFFY MMNTGHDILM GSKWGSAAAD SCCNLNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A2e-1571129262HAPB protein
4g92_A2e-1571129262HAPB protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016508495.11e-178PREDICTED: nuclear transcription factor Y subunit A-10-like, partial
TrEMBLM1BXA51e-96M1BXA5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000550613e-96(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37062347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.32e-44nuclear factor Y, subunit A10